PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P14840_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family MYB
Protein Properties Length: 869aa    MW: 95688.7 Da    PI: 6.3174
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P14840_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-174187148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g WT+eEd +l++av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  GSMUA_Achr10P14840_001 41 KGQWTAEEDAILYRAVQSFKGKHWKKIAECFP-DRTDVQCLHRWQKVL 87
                            799*****************************.************986 PP

2Myb_DNA-binding60.53.7e-1993139148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                             +g+W++eEde+++d vk++G++ W++Ia+ ++ gR +kqc++rw+++l
  GSMUA_Achr10P14840_001  93 KGPWSKEEDEIIIDMVKKFGPKKWSAIAQALP-GRIGKQCRERWHNHL 139
                             79******************************.*************97 PP

3Myb_DNA-binding482.8e-15145187145
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                             + +WT+eE+  l++a++ +G++ W+   + ++ gRt++ +k++w+
  GSMUA_Achr10P14840_001 145 KEPWTQEEEIALIHAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 187
                             679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.0023687IPR017930Myb domain
SuperFamilySSF466892.73E-153793IPR009057Homeodomain-like
SMARTSM007173.9E-154089IPR001005SANT/Myb domain
PfamPF002494.7E-154187IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-2343103IPR009057Homeodomain-like
CDDcd001671.44E-134487No hitNo description
PROSITE profilePS5129431.50488143IPR017930Myb domain
SuperFamilySSF466895.62E-3290186IPR009057Homeodomain-like
SMARTSM007172.3E-1892141IPR001005SANT/Myb domain
CDDcd001672.60E-1695139No hitNo description
PfamPF139214.0E-1896156No hitNo description
Gene3DG3DSA:1.10.10.604.4E-27104146IPR009057Homeodomain-like
PROSITE profilePS5129419.883144194IPR017930Myb domain
SMARTSM007178.2E-15144192IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-22147194IPR009057Homeodomain-like
CDDcd001671.40E-11147187No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 869 aa     Download sequence    Send to blast
MIMAFGILCL NKSISIRLVV EVTSERINVE KITGPTRRST KGQWTAEEDA ILYRAVQSFK  60
GKHWKKIAEC FPDRTDVQCL HRWQKVLNPE LVKGPWSKEE DEIIIDMVKK FGPKKWSAIA  120
QALPGRIGKQ CRERWHNHLN PAINKEPWTQ EEEIALIHAH QIYGNKWAEL TKFLPGRTDN  180
AIKNHWNSSV KKKINLYLAS GLLSDRKDIQ DSHLSICMND YYAYMEDFAR AVPEEQSKVS  240
ASANLLLTEE ISQKSPGLTE ASEYHSVCRT NNENGSSDLL VCETGCFSNY LSGLDVLQGG  300
IEECPIEFDD SSFGNLDYYS GTICQNSFSS EACKSLTSCP NPVSSSGMLG ISYDDNLVAV  360
LPHSCGSDGR LYRNSTLETR DISVEAHDSD VIICSYDGIA YSSCSSLCPS DSSKSKFFLP  420
EDKRQEIGAP KQTNTVMMVS ATPNTNHKAM SSDENLSVQS ADLSDSGALF YEPPCFPSLE  480
IPFISCDLIS SGDPQQAYSP LGIRQLMMSS VNCSKPYSLW DSPSHDESPN AHLKGAVKSF  540
MYTPSILKKR QREMSSPIPE QRTDKKPDKE NLCQSSCYAT AGNVVMEAKT PANSYGKMAS  600
FTSATSAASK VDTGASKWRV KNHSSFVVIV PQPPRILVEC NANNKVFFSP RGTRYPTNGS  660
LNVGAKALKD SHCVSIISVQ SDPSTHPSFA VEKCSSTVDD DIRHLNIFVD TPGVKRGIES  720
PSAWKSPWFV NSLLPVHGIG TDTAFEDMGY LMSPGDQSYD AIGLMRQLSE HTAAAVAEAQ  780
EVLISGSPVR ACNGPQSDNK KFSDENADPA DKELGNYHMP SKIMTEARVL DFSGCGTPVN  840
KRSENVKAGN TETPISLSSQ SSYLMKVCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-68411946159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-68411946159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009421206.10.0PREDICTED: myb-related protein 3R-1-like isoform X2
TrEMBLM0RIB00.0M0RIB0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P14840_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-96myb domain protein 3r-4